SCOPe 2.04: Domain d3hzre_: 3hzr E:

Lineage for d3hzre_ (3hzr E:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [255876] (1 PDB entry)

8. Domain d3hzre_: 3hzr E: [246638]
   automated match to d1ulhb_

Details for d3hzre_

PDB Entry: 3hzr, 3 Å

PDB Description: Tryptophanyl-tRNA synthetase homolog from Entamoeba histolytica

PDB Compounds: (E:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3hzre_:

Sequence; same for both SEQRES and ATOM records:

>d3hzre_ c.26.1.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
psqllqsfttrttdynqlinsvginaitpqqiqrieklsgkaphhylsrgvflaeksldk
flddveakkptfifiqkypqkevaleeyitlefarylqdafniqviiqilddikvlnrea
tineaskmsndlmkyilafgfnedktfiytdyqyfgkmyrtislvekataynvvqpffnf
eysdnigklaspsimtasmfsqsyshffssparclvldsiknvqfhsiidqiattlnfiq
ptvlfhkmvpllsgvtkfdipsdhnsillsdnakqverkinklafsggrntteehkklgg
qcdidvsfqllnifssdnaqvkdveekyskgellsgelkkivsasmkdfivaydakkkpi
ttaylkayisktkf

Timeline for d3hzre_:

• d3hzre_ is new in SCOPe 2.04-stable
  
• d3hzre_ appears in SCOPe 2.05
  
• d3hzre_ appears in the current release, SCOPe 2.08