SCOPe 2.08: Domain d3hzoa1: 3hzo A:2-261

Lineage for d3hzoa1 (3hzo A:2-261)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)

8. Domain d3hzoa1: 3hzo A:2-261 [246632]
   Other proteins in same PDB: d3hzoa2
   automated match to d3hssb_
   complexed with edo, mla, na

Details for d3hzoa1

PDB Entry: 3hzo, 2.6 Å

PDB Description: rv0554 from mycobacterium tuberculosis - the structure solved from the tetragonal crystal form

PDB Compounds: (A:) protein Rv0554, putative Bromoperoxidase

SCOPe Domain Sequences for d3hzoa1:

Sequence; same for both SEQRES and ATOM records:

>d3hzoa1 c.69.1.0 (A:2-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvk

Timeline for d3hzoa1:

• d3hzoa1 first appeared in SCOPe 2.04, called d3hzoa_
  
• d3hzoa1 appears in SCOPe 2.07