SCOPe 2.05: Domain d3hw8a2: 3hw8 A:329-385

Lineage for d3hw8a2 (3hw8 A:329-385)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (26 PDB entries)

8. Domain d3hw8a2: 3hw8 A:329-385 [246599]
   Other proteins in same PDB: d3hw8a1, d3hw8a3
   automated match to d1xsna2
   protein/DNA complex; complexed with d3t, edo, mg, na

Details for d3hw8a2

PDB Entry: 3hw8, 1.95 Å

PDB Description: ternary complex of dna polymerase lambda of a two nucleotide gapped dna substrate with a c in the scrunch site

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3hw8a2:

Sequence; same for both SEQRES and ATOM records:

>d3hw8a2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d3hw8a2:

• d3hw8a2 first appeared in SCOPe 2.04
  
• d3hw8a2 appears in SCOPe 2.06
  
• d3hw8a2 appears in the current release, SCOPe 2.08