Lineage for d1g31c_ (1g31 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785354Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2785469Protein GP31 co-chaperonin [50134] (1 species)
  7. 2785470Species Bacteriophage T4 [TaxId:10665] [50135] (2 PDB entries)
  8. 2785473Domain d1g31c_: 1g31 C: [24658]
    complexed with k, po4

Details for d1g31c_

PDB Entry: 1g31 (more details), 2.3 Å

PDB Description: gp31 co-chaperonin from bacteriophage t4
PDB Compounds: (C:) gp31

SCOPe Domain Sequences for d1g31c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g31c_ b.35.1.1 (C:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]}
qqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpegfce
vgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk

SCOPe Domain Coordinates for d1g31c_:

Click to download the PDB-style file with coordinates for d1g31c_.
(The format of our PDB-style files is described here.)

Timeline for d1g31c_: