SCOPe 2.04: Domain d3huna2: 3hun A:316-383

Lineage for d3huna2 (3hun A:316-383)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
   rudiment form of the PBP-5-like domain
   automatically mapped to Pfam PF09211

6. Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries)
   Uniprot Q53613 21-383

8. Domain d3huna2: 3hun A:316-383 [246573]
   Other proteins in same PDB: d3huna1, d3hunb1
   automated match to d3humb2
   complexed with zz7

Details for d3huna2

PDB Entry: 3hun, 2 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with ampicillin

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huna2:

Sequence; same for both SEQRES and ATOM records:

>d3huna2 b.105.1.2 (A:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

Timeline for d3huna2:

• d3huna2 is new in SCOPe 2.04-stable
  
• d3huna2 appears in SCOPe 2.05
  
• d3huna2 appears in the current release, SCOPe 2.08