Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries) |
Domain d3hu3a3: 3hu3 A:201-469 [246568] Other proteins in same PDB: d3hu3a1, d3hu3a2, d3hu3b1, d3hu3b2 automated match to d1e32a2 complexed with ags, mg; mutant |
PDB Entry: 3hu3 (more details), 2.2 Å
SCOPe Domain Sequences for d3hu3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu3a3 c.37.1.20 (A:201-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae vmnslavtmddfrwalsqsnpsalretvv
Timeline for d3hu3a3: