Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) |
Family d.31.1.0: automated matches [254296] (1 protein) not a true family |
Protein automated matches [254681] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries) |
Domain d3hu1b2: 3hu1 B:107-200 [246534] Other proteins in same PDB: d3hu1a1, d3hu1a3, d3hu1b1, d3hu1b3, d3hu1c1, d3hu1c3, d3hu1d1, d3hu1d3, d3hu1e1, d3hu1e3, d3hu1f1, d3hu1f3 automated match to d1e32a3 complexed with ags, mg; mutant |
PDB Entry: 3hu1 (more details), 2.81 Å
SCOPe Domain Sequences for d3hu1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu1b2 d.31.1.0 (B:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv etdpspycivapdtvihcegepikredeeeslne
Timeline for d3hu1b2: