SCOPe 2.08: Domain d3hmwl1: 3hmw L:1-106

Lineage for d3hmwl1 (3hmw L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3hmwl1: 3hmw L:1-106 [246514]
   Other proteins in same PDB: d3hmwl2
   automated match to d1dn0a1
   complexed with cd

Details for d3hmwl1

PDB Entry: 3hmw, 3 Å

PDB Description: crystal structure of ustekinumab fab

PDB Compounds: (L:) ustekinumab fab light chain

SCOPe Domain Sequences for d3hmwl1:

Sequence; same for both SEQRES and ATOM records:

>d3hmwl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisswlawyqqkpekapksliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqyniypytfgqgtklei

Timeline for d3hmwl1:

• d3hmwl1 first appeared in SCOPe 2.04
  
• d3hmwl1 appears in SCOPe 2.07