SCOPe 2.08: Domain d3hbwa_: 3hbw A:

Lineage for d3hbwa_ (3hbw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)

8. Domain d3hbwa_: 3hbw A: [246489]
   automated match to d1q1ua_

Details for d3hbwa_

PDB Entry: 3hbw, 1.9 Å

PDB Description: Crystal Structure of Human Fibroblast Growth Factor Homologous Factor 2A (FHF2A), also referred to as Fibroblast Growth Factor 13A (FGF13A)

PDB Compounds: (A:) Fibroblast growth factor 13

SCOPe Domain Sequences for d3hbwa_:

Sequence; same for both SEQRES and ATOM records:

>d3hbwa_ b.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
hvkknkpaahflpkplkvamykepslhdl

Timeline for d3hbwa_:

• d3hbwa_ first appeared in SCOPe 2.04
  
• d3hbwa_ appears in SCOPe 2.07