SCOPe 2.06: Domain d3h77b2: 3h77 B:177-329

Lineage for d3h77b2 (3h77 B:177-329)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [227637] (5 PDB entries)

8. Domain d3h77b2: 3h77 B:177-329 [246481]
   Other proteins in same PDB: d3h77a3, d3h77b3
   complexed with cow

Details for d3h77b2

PDB Entry: 3h77, 1.8 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa PqsD in a covalent complex with anthranilate

PDB Compounds: (B:) PQS biosynthetic enzyme

SCOPe Domain Sequences for d3h77b2:

Sequence; same for both SEQRES and ATOM records:

>d3h77b2 c.95.1.0 (B:177-329) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glldlrlgadgnyfdllmtaapgsasptfldenvlregggeflmrgrpmfehasqtlvri
agemlaaheltlddidhvichqpnlrildavqeqlgipqhkfavtvdrlgnmasastpvt
lamfwpdiqpgqrvlvltygsgatwgaalyrkp

Timeline for d3h77b2:

• d3h77b2 first appeared in SCOPe 2.04
  
• d3h77b2 appears in SCOPe 2.05
  
• d3h77b2 appears in SCOPe 2.07
  
• d3h77b2 appears in the current release, SCOPe 2.08