Lineage for d3h4ma_ (3h4m A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598313Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (5 PDB entries)
  8. 1598322Domain d3h4ma_: 3h4m A: [246464]
    automated match to d1iy2a_
    complexed with adp

Details for d3h4ma_

PDB Entry: 3h4m (more details), 3.11 Å

PDB Description: AAA ATPase domain of the proteasome- activating nucleotidase
PDB Compounds: (A:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d3h4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h4ma_ c.37.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
amevderpnvryedigglekqmqeirevvelplkhpelfekvgieppkgillygppgtgk
tllakavatetnatfirvvgselvkkfigegaslvkdifklakekapsiifideidaiaa
krtdaltggdrevqrtlmqllaemdgfdargdvkiigatnrpdildpailrpgrfdriie
vpapdekgrleilkihtrkmnlaedvnleeiakmtegcvgaelkaicteagmnairelrd
yvtmddfrkavekimekkkvk

SCOPe Domain Coordinates for d3h4ma_:

Click to download the PDB-style file with coordinates for d3h4ma_.
(The format of our PDB-style files is described here.)

Timeline for d3h4ma_: