| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
| Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
| Protein automated matches [190326] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries) |
| Domain d3h1jw_: 3h1j W: [246461] Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_ automated match to d3l75j_ complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1jw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1jw_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyeas
Timeline for d3h1jw_:
View in 3DDomains from other chains: (mouse over for more information) d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_ |