Lineage for d3h1jt_ (3h1j T:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631316Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2631317Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2631364Protein automated matches [191133] (1 species)
    not a true protein
  7. 2631365Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)
  8. 2631375Domain d3h1jt_: 3h1j T: [246459]
    Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1ju_, d3h1jw_
    automated match to d3l75g_
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jt_

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (T:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3h1jt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1jt_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys
wgtqeferlkrknpadyen

SCOPe Domain Coordinates for d3h1jt_:

Click to download the PDB-style file with coordinates for d3h1jt_.
(The format of our PDB-style files is described here.)

Timeline for d3h1jt_: