SCOPe 2.07: Domain d3h1jp2: 3h1j P:262-380

Lineage for d3h1jp2 (3h1j P:262-380)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries)

8. Domain d3h1jp2: 3h1j P:262-380 [246455]
   Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_
   automated match to d3l75c2
   complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jp2

PDB Entry: 3h1j, 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3h1jp2:

Sequence; same for both SEQRES and ATOM records:

>d3h1jp2 f.32.1.0 (P:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

Timeline for d3h1jp2:

• d3h1jp2 first appeared in SCOPe 2.04
  
• d3h1jp2 appears in SCOPe 2.06
  
• d3h1jp2 appears in the current release, SCOPe 2.08