| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.0: automated matches [254197] (1 protein) not a true family |
| Protein automated matches [254431] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries) |
| Domain d3h1jp2: 3h1j P:262-380 [246455] Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ automated match to d3l75c2 complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1jp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1jp2 f.32.1.0 (P:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3h1jp2:
View in 3DDomains from other chains: (mouse over for more information) d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ |