Lineage for d3h1hw_ (3h1h W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026053Protein automated matches [190326] (4 species)
    not a true protein
  7. 3026066Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries)
  8. 3026080Domain d3h1hw_: 3h1h W: [246437]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_
    automated match to d3l75j_
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hw_

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (W:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d3h1hw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hw_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease

SCOPe Domain Coordinates for d3h1hw_:

Click to download the PDB-style file with coordinates for d3h1hw_.
(The format of our PDB-style files is described here.)

Timeline for d3h1hw_: