Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein automated matches [190042] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries) |
Domain d3h1hu_: 3h1h U: [246436] Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hw_ automated match to d3l75h_ complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hu_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah klfnklk
Timeline for d3h1hu_:
View in 3D Domains from other chains: (mouse over for more information) d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hw_ |