Lineage for d3h1ht_ (3h1h T:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254451Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2254452Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2254494Protein automated matches [191133] (1 species)
    not a true protein
  7. 2254495Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)
  8. 2254499Domain d3h1ht_: 3h1h T: [246435]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1hu_, d3h1hw_
    automated match to d3l75g_
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1ht_

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (T:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3h1ht_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1ht_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyend

SCOPe Domain Coordinates for d3h1ht_:

Click to download the PDB-style file with coordinates for d3h1ht_.
(The format of our PDB-style files is described here.)

Timeline for d3h1ht_: