Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries) |
Domain d3h1hp1: 3h1h P:2-261 [246430] Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l75p1 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hp1 f.21.1.2 (P:2-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl tlalfspnllgdpenftpan
Timeline for d3h1hp1:
View in 3D Domains from other chains: (mouse over for more information) d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ |