Lineage for d3h1hh_ (3h1h H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633101Protein automated matches [190042] (4 species)
    not a true protein
  7. 2633102Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 2633115Domain d3h1hh_: 3h1h H: [246424]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hw_
    automated match to d3l75h_
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hh_

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d3h1hh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hh_ f.28.1.1 (H:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
eeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhc
vahklfnklk

SCOPe Domain Coordinates for d3h1hh_:

Click to download the PDB-style file with coordinates for d3h1hh_.
(The format of our PDB-style files is described here.)

Timeline for d3h1hh_: