Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
Domain d3h1hb1: 3h1h B:19-235 [246416] Other proteins in same PDB: d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l71o1 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hb1 d.185.1.0 (B:19-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} pgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlasplttk gassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwevt dlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqnn ftsarmalvgigvkhsdlkqvaeqflnirsgagtssa
Timeline for d3h1hb1:
View in 3D Domains from other chains: (mouse over for more information) d3h1ha1, d3h1ha2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ |