Lineage for d3h0uc_ (3h0u C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113664Species Streptomyces avermitilis [TaxId:33903] [255855] (1 PDB entry)
  8. 2113667Domain d3h0uc_: 3h0u C: [246408]
    Other proteins in same PDB: d3h0ua2
    automated match to d3swxa_
    complexed with dms, na

Details for d3h0uc_

PDB Entry: 3h0u (more details), 1.5 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis
PDB Compounds: (C:) Putative enoyl-CoA hydratase

SCOPe Domain Sequences for d3h0uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0uc_ c.14.1.0 (C:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
tasyetikarldgtvlsatfnappmnligpevvrdlvalleelahptaprvvifdsadad
fffphvdmtkvpeytaeaakaggpgdaslgmlfrklsqlpavtiaklrgrargagsefll
acdmrfasrenailgqpevgigappgagaiqhltrllgrgraleavltssdfdadlaery
gwvnravpdaeldefvagiaarmsgfprdaliaaksainaislpapaevradaalfqqlv
rgekvqqrtaelfkqgfqtrgateldlgdalghl

SCOPe Domain Coordinates for d3h0uc_:

Click to download the PDB-style file with coordinates for d3h0uc_.
(The format of our PDB-style files is described here.)

Timeline for d3h0uc_: