SCOPe 2.04: Domain d3h0uc_: 3h0u C:

Lineage for d3h0uc_ (3h0u C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:33903] [255855] (1 PDB entry)

8. Domain d3h0uc_: 3h0u C: [246408]
   automated match to d3swxa_
   complexed with dms, na

Details for d3h0uc_

PDB Entry: 3h0u, 1.5 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis

PDB Compounds: (C:) Putative enoyl-CoA hydratase

SCOPe Domain Sequences for d3h0uc_:

Sequence; same for both SEQRES and ATOM records:

>d3h0uc_ c.14.1.0 (C:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
tasyetikarldgtvlsatfnappmnligpevvrdlvalleelahptaprvvifdsadad
fffphvdmtkvpeytaeaakaggpgdaslgmlfrklsqlpavtiaklrgrargagsefll
acdmrfasrenailgqpevgigappgagaiqhltrllgrgraleavltssdfdadlaery
gwvnravpdaeldefvagiaarmsgfprdaliaaksainaislpapaevradaalfqqlv
rgekvqqrtaelfkqgfqtrgateldlgdalghl

Timeline for d3h0uc_:

• d3h0uc_ is new in SCOPe 2.04-stable
  
• d3h0uc_ appears in SCOPe 2.05
  
• d3h0uc_ appears in the current release, SCOPe 2.08