Lineage for d3gzni1 (3gzn I:1-76)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931416Protein Nedd8 [54244] (1 species)
  7. 2931417Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2931437Domain d3gzni1: 3gzn I:1-76 [246400]
    Other proteins in same PDB: d3gzna_, d3gznb_, d3gznc_, d3gznd_, d3gzni2, d3gznj2
    automated match to d2bkrb_
    complexed with b39, zn

Details for d3gzni1

PDB Entry: 3gzn (more details), 3 Å

PDB Description: Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924
PDB Compounds: (I:) nedd8

SCOPe Domain Sequences for d3gzni1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzni1 d.15.1.1 (I:1-76) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d3gzni1:

Click to download the PDB-style file with coordinates for d3gzni1.
(The format of our PDB-style files is described here.)

Timeline for d3gzni1: