Lineage for d3gzna_ (3gzn A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1629771Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 1629772Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 1629779Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 1629780Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion
  7. 1629781Species Human (Homo sapiens) [TaxId:9606] [89767] (9 PDB entries)
    Uniprot Q13564
  8. 1629795Domain d3gzna_: 3gzn A: [246396]
    Other proteins in same PDB: d3gznb_, d3gznd_, d3gzni_, d3gznj_
    automated match to d1tt5a_
    complexed with b39, zn

Details for d3gzna_

PDB Entry: 3gzn (more details), 3 Å

PDB Description: Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924
PDB Compounds: (A:) NEDD8-activating enzyme E1 regulatory subunit

SCOPe Domain Sequences for d3gzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzna_ c.111.1.2 (A:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
lkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsg
edagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvv
atqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldk
pfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdli
rqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwil
aralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqs
igqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlyl
mlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcryga
aephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOPe Domain Coordinates for d3gzna_:

Click to download the PDB-style file with coordinates for d3gzna_.
(The format of our PDB-style files is described here.)

Timeline for d3gzna_: