Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [232341] (2 PDB entries) |
Domain d3gweb1: 3gwe B:8-184 [246374] |
PDB Entry: 3gwe (more details), 2.1 Å
SCOPe Domain Sequences for d3gweb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gweb1 c.95.1.0 (B:8-184) automated matches {Burkholderia pseudomallei [TaxId: 320372]} praaiadiaghlpeqvltndvlaqlypdwpaekilaktgirerriaapretaadlayeaa rklfaqgavgadqvdfvilctqapdyvlptsacmlqhrlgipthagaldvnlgcsgyvyg lslakglvetgaarcvllltadtyskylhpldksvrtlfgdgasataviaehgeler
Timeline for d3gweb1: