Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [255849] (1 PDB entry) |
Domain d3glxa1: 3glx A:6-64 [246326] Other proteins in same PDB: d3glxa2, d3glxa3 automated match to d2dtra1 protein/DNA complex; complexed with ni, po4 |
PDB Entry: 3glx (more details), 1.85 Å
SCOPe Domain Sequences for d3glxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glxa1 a.4.5.0 (A:6-64) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} dttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslqm
Timeline for d3glxa1: