Lineage for d3glxa1 (3glx A:6-64)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1722932Species Corynebacterium diphtheriae [TaxId:1717] [255849] (1 PDB entry)
  8. 1722933Domain d3glxa1: 3glx A:6-64 [246326]
    Other proteins in same PDB: d3glxa2, d3glxa3
    automated match to d2dtra1
    protein/DNA complex; complexed with ni, po4

Details for d3glxa1

PDB Entry: 3glx (more details), 1.85 Å

PDB Description: crystal structure analysis of the dtxr(e175k) complexed with ni(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d3glxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glxa1 a.4.5.0 (A:6-64) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
dttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslqm

SCOPe Domain Coordinates for d3glxa1:

Click to download the PDB-style file with coordinates for d3glxa1.
(The format of our PDB-style files is described here.)

Timeline for d3glxa1: