SCOPe 2.05: Domain d3gd6a1: 3gd6 A:1-122

Lineage for d3gd6a1 (3gd6 A:1-122)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [255837] (3 PDB entries)

8. Domain d3gd6a1: 3gd6 A:1-122 [246279]
   Other proteins in same PDB: d3gd6a2
   automated match to d3sjna1
   complexed with po4

Details for d3gd6a1

PDB Entry: 3gd6, 1.6 Å

PDB Description: crystal structure of divergent enolase from oceanobacillus iheyensis complexed with phosphate

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3gd6a1:

Sequence; same for both SEQRES and ATOM records:

>d3gd6a1 d.54.1.0 (A:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

Timeline for d3gd6a1:

• d3gd6a1 first appeared in SCOPe 2.04
  
• d3gd6a1 appears in SCOPe 2.06
  
• d3gd6a1 appears in the current release, SCOPe 2.08