Lineage for d3g9za_ (3g9z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871654Species Uncultured bacterium [TaxId:77133] [196706] (15 PDB entries)
  8. 1871667Domain d3g9za_: 3g9z A: [246274]
    automated match to d3faka_

Details for d3g9za_

PDB Entry: 3g9z (more details), 2.2 Å

PDB Description: Crystal structure of EstE5, was soaked by p-nitrophenyl caprylate
PDB Compounds: (A:) Esterase/lipase

SCOPe Domain Sequences for d3g9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9za_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
magpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvr
apgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaaved
gvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtct
ndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkglppllihvgrdevl
lddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa

SCOPe Domain Coordinates for d3g9za_:

Click to download the PDB-style file with coordinates for d3g9za_.
(The format of our PDB-style files is described here.)

Timeline for d3g9za_: