Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (10 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255843] (2 PDB entries) |
Domain d3g8db3: 3g8d B:331-444 [246270] Other proteins in same PDB: d3g8da1, d3g8db1, d3g8db2 automated match to d2w70a3 complexed with adp, mg, so4; mutant |
PDB Entry: 3g8d (more details), 1.9 Å
SCOPe Domain Sequences for d3g8db3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8db3 b.84.2.0 (B:331-444) automated matches {Escherichia coli K-12 [TaxId: 83333]} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl
Timeline for d3g8db3: