SCOPe 2.04: Domain d3g7ba_: 3g7b A:

Lineage for d3g7ba_ (3g7b A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (9 PDB entries)

8. Domain d3g7ba_: 3g7b A: [246254]
   automated match to d3g75b_
   complexed with b47

Details for d3g7ba_

PDB Entry: 3g7b, 2.3 Å

PDB Description: staphylococcus aureus gyrase b co-complex with methyl ({5-[4-(4-hydroxypiperidin-1-yl)-2-phenyl-1,3-thiazol-5-yl]-1h-pyrazol-3-yl}methyl)carbamate inhibitor

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3g7ba_:

Sequence; same for both SEQRES and ATOM records:

>d3g7ba_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

Timeline for d3g7ba_:

• d3g7ba_ is new in SCOPe 2.04-stable
  
• d3g7ba_ appears in SCOPe 2.05
  
• d3g7ba_ appears in the current release, SCOPe 2.08