Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (11 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (9 PDB entries) |
Domain d3g7ba_: 3g7b A: [246254] automated match to d3g75b_ complexed with b47 |
PDB Entry: 3g7b (more details), 2.3 Å
SCOPe Domain Sequences for d3g7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7ba_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds yhye
Timeline for d3g7ba_: