SCOPe 2.06: Domain d3g38a1: 3g38 A:2-257

Lineage for d3g38a1 (3g38 A:2-257)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (12 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)

8. Domain d3g38a1: 3g38 A:2-257 [246232]
   Other proteins in same PDB: d3g38a2
   automated match to d3g4tb_
   protein/DNA complex; complexed with gol; mutant

Details for d3g38a1

PDB Entry: 3g38, 3.04 Å

PDB Description: the catalytically inactive mutant mth0212 (d151n) in complex with an 8 bp dsdna

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g38a1:

Sequence; same for both SEQRES and ATOM records:

>d3g38a1 d.151.1.0 (A:2-257) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel

Timeline for d3g38a1:

• d3g38a1 first appeared in SCOPe 2.04, called d3g38a_
  
• d3g38a1 was called d3g38a_ in SCOPe 2.05
  
• d3g38a1 appears in SCOPe 2.07
  
• d3g38a1 appears in the current release, SCOPe 2.08