Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Domain d3fznb3: 3fzn B:342-524 [246216] Other proteins in same PDB: d3fzna2, d3fznb2, d3fznc2, d3fznd2 automated match to d1q6za3 complexed with cl, d7k, mg, peg, po4 |
PDB Entry: 3fzn (more details), 1.62 Å
SCOPe Domain Sequences for d3fznb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fznb3 c.36.1.0 (B:342-524) automated matches {Pseudomonas putida [TaxId: 303]} epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev stv
Timeline for d3fznb3: