Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Benzoylformate decarboxylase [52482] (1 species) |
Species Pseudomonas putida [TaxId:303] [52483] (41 PDB entries) Uniprot P20906 |
Domain d3fznb2: 3fzn B:182-341 [246215] Other proteins in same PDB: d3fzna1, d3fzna3, d3fznb1, d3fznb3, d3fznc1, d3fznc3, d3fznd1, d3fznd3 automated match to d1q6za1 complexed with cl, d7k, mg, peg, po4 |
PDB Entry: 3fzn (more details), 1.62 Å
SCOPe Domain Sequences for d3fznb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fznb2 c.31.1.3 (B:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d3fznb2: