SCOPe 2.04: Domain d3fxla1: 3fxl A:2-296

Lineage for d3fxla1 (3fxl A:2-296)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.219: PP2C-like [81607] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; antiparallel beta sheets

4. Superfamily d.219.1: PP2C-like [81606] (2 families)
   contain binuclear metal (Mn) centre

5. Family d.219.1.1: PP2C-like [81605] (3 proteins)
   Pfam PF00481

6. Protein automated matches [232201] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232202] (5 PDB entries)

8. Domain d3fxla1: 3fxl A:2-296 [246192]
   Other proteins in same PDB: d3fxla2
   automated match to d3fxja1
   complexed with flc, mn, po4

Details for d3fxla1

PDB Entry: 3fxl, 2.3 Å

PDB Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Citrate at 1 mM of Mn2+

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d3fxla1:

Sequence; same for both SEQRES and ATOM records:

>d3fxla1 d.219.1.1 (A:2-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

Timeline for d3fxla1:

• d3fxla1 is new in SCOPe 2.04-stable
  
• d3fxla1 appears in SCOPe 2.05
  
• d3fxla1 appears in the current release, SCOPe 2.08