SCOPe 2.08: Domain d3fubd_: 3fub D:

Lineage for d3fubd_ (3fub D:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein automated matches [190307] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)

8. Domain d3fubd_: 3fub D: [246187]
   automated match to d2v5eb_
   complexed with edo, nag, so4

Details for d3fubd_

PDB Entry: 3fub, 2.35 Å

PDB Description: crystal structure of gdnf-gfralpha1 complex

PDB Compounds: (D:) glial cell line-derived neurotrophic factor

SCOPe Domain Sequences for d3fubd_:

Sequence; same for both SEQRES and ATOM records:

>d3fubd_ g.17.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqrgknrgcvltaihlnvtdlglgyetkeelifrycsgscdaaettydkilknlsrnrr
lvsdkvgqaccrpiafdddlsflddnlvyhilrkhsakrcgci

Timeline for d3fubd_:

• d3fubd_ first appeared in SCOPe 2.04
  
• d3fubd_ appears in SCOPe 2.07