Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein automated matches [190307] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries) |
Domain d3fubd_: 3fub D: [246187] automated match to d2v5eb_ complexed with edo, nag, so4 |
PDB Entry: 3fub (more details), 2.35 Å
SCOPe Domain Sequences for d3fubd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fubd_ g.17.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgqrgknrgcvltaihlnvtdlglgyetkeelifrycsgscdaaettydkilknlsrnrr lvsdkvgqaccrpiafdddlsflddnlvyhilrkhsakrcgci
Timeline for d3fubd_: