Lineage for d3fmob_ (3fmo B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872332Domain d3fmob_: 3fmo B: [246166]
    automated match to d3fhcb_
    protein/RNA complex; complexed with adp, gol

Details for d3fmob_

PDB Entry: 3fmo (more details), 2.51 Å

PDB Description: crystal structure of the nucleoporin nup214 in complex with the dead- box helicase ddx19
PDB Compounds: (B:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3fmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fmob_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmla
eppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkf
ypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmi
atqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkre

SCOPe Domain Coordinates for d3fmob_:

Click to download the PDB-style file with coordinates for d3fmob_.
(The format of our PDB-style files is described here.)

Timeline for d3fmob_: