Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries) |
Domain d3ff6b1: 3ff6 B:1697-2017 [246101] automated match to d4asib1 complexed with rcp |
PDB Entry: 3ff6 (more details), 3.19 Å
SCOPe Domain Sequences for d3ff6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ff6b1 c.14.1.0 (B:1697-2017) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelvldsqgql vemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedllylrasem araegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdytrissln svhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtislvtcrai gigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyngvshitv pddfegvytilewlsympkdn
Timeline for d3ff6b1: