SCOPe 2.04: Domain d3ff6a1: 3ff6 A:1695-2017

Lineage for d3ff6a1 (3ff6 A:1695-2017)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)

8. Domain d3ff6a1: 3ff6 A:1695-2017 [246099]
   automated match to d4asib1
   complexed with rcp

Details for d3ff6a1

PDB Entry: 3ff6, 3.19 Å

PDB Description: human acc2 ct domain with cp-640186

PDB Compounds: (A:) Acetyl-CoA carboxylase 2

SCOPe Domain Sequences for d3ff6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ff6a1 c.14.1.0 (A:1695-2017) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyvtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelvldsqg
qlvemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedllylras
emaraegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdytriss
lnsvhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtislvtcr
aigigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyngvshi
tvpddfegvytilewlsympkdn

Timeline for d3ff6a1:

• d3ff6a1 is new in SCOPe 2.04-stable
  
• d3ff6a1 appears in SCOPe 2.05
  
• d3ff6a1 appears in the current release, SCOPe 2.08