Lineage for d3fdca_ (3fdc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806127Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2806215Domain d3fdca_: 3fdc A: [246091]
    automated match to d4i60a_
    complexed with btf

Details for d3fdca_

PDB Entry: 3fdc (more details), 3.1 Å

PDB Description: Crystal Structure of Avidin
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d3fdca_:

Sequence, based on SEQRES records: (download)

>d3fdca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqpt
fgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Sequence, based on observed residues (ATOM records): (download)

>d3fdca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatneikesplhgtentinkrtqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOPe Domain Coordinates for d3fdca_:

Click to download the PDB-style file with coordinates for d3fdca_.
(The format of our PDB-style files is described here.)

Timeline for d3fdca_: