SCOPe 2.04: Domain d3fd4a_: 3fd4 A:

Lineage for d3fd4a_ (3fd4 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (7 species)
   not a true protein

7. Species Human herpesvirus 4 (strain b95-8) [TaxId:10377] [255828] (1 PDB entry)

8. Domain d3fd4a_: 3fd4 A: [246089]
   automated match to d1kg0c_

Details for d3fd4a_

PDB Entry: 3fd4, 2.4 Å

PDB Description: crystal structure of epstein-barr virus gp42 protein

PDB Compounds: (A:) Glycoprotein gp42

SCOPe Domain Sequences for d3fd4a_:

Sequence; same for both SEQRES and ATOM records:

>d3fd4a_ d.169.1.1 (A:) automated matches {Human herpesvirus 4 (strain b95-8) [TaxId: 10377]}
ptlhtfqvpqnytkanctycntreytfsykgccfyftkkkhtwngcfqacaelypctyfy
gptpdilpvvtrnlnaieslwvgvyrvgegnwtsldggtfkvyqifgshctyvskfstvp
vshhecsflkpclcvsqrsn

Timeline for d3fd4a_:

• d3fd4a_ is new in SCOPe 2.04-stable
  
• d3fd4a_ appears in SCOPe 2.05
  
• d3fd4a_ appears in the current release, SCOPe 2.08