SCOPe 2.06: Domain d3fcyb_: 3fcy B:

Lineage for d3fcyb_ (3fcy B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Thermoanaerobacterium sp. [TaxId:60708] [255827] (1 PDB entry)

8. Domain d3fcyb_: 3fcy B: [246087]
   automated match to d1l7aa_
   complexed with ca

Details for d3fcyb_

PDB Entry: 3fcy, 2.1 Å

PDB Description: crystal structure of acetyl xylan esterase 1 from thermoanaerobacterium sp. jw/sl ys485

PDB Compounds: (B:) Xylan esterase 1

SCOPe Domain Sequences for d3fcyb_:

Sequence; same for both SEQRES and ATOM records:

>d3fcyb_ c.69.1.0 (B:) automated matches {Thermoanaerobacterium sp. [TaxId: 60708]}
fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftg
vrgarihakyikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqs
qdvggvtgntlnghiirgldddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsq
ggglslacaaleprvrkvvseypflsdykrvwdldlaknayqeitdyfrlfdprherene
vftklgyidvknlakrikgdvlmcvglmdqvcppstvfaaynniqskkdikvypdyghep
mrgfgdlamqfmlelys

Timeline for d3fcyb_:

• d3fcyb_ first appeared in SCOPe 2.04
  
• d3fcyb_ appears in SCOPe 2.05
  
• d3fcyb_ appears in SCOPe 2.07
  
• d3fcyb_ appears in the current release, SCOPe 2.08