SCOPe 2.04: Domain d3fcjd1: 3fcj D:2-260

Lineage for d3fcjd1 (3fcj D:2-260)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein automated matches [226961] (2 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231929] (7 PDB entries)

8. Domain d3fcjd1: 3fcj D:2-260 [246084]
   Other proteins in same PDB: d3fcja2, d3fcjb2, d3fcjc2, d3fcjd2
   automated match to d3d9da1
   complexed with fad, gol, nie; mutant

Details for d3fcjd1

PDB Entry: 3fcj, 2.4 Å

PDB Description: nitroalkane oxidase: mutant402n crystallized with nitroethane

PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d3fcjd1:

Sequence; same for both SEQRES and ATOM records:

>d3fcjd1 e.6.1.1 (D:2-260) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d3fcjd1:

• d3fcjd1 is new in SCOPe 2.04-stable
  
• d3fcjd1 appears in SCOPe 2.05
  
• d3fcjd1 appears in the current release, SCOPe 2.08