Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries) |
Domain d3fb6c_: 3fb6 C: [246074] Other proteins in same PDB: d3fb6b1, d3fb6b2 automated match to d1r3jc_ complexed with k |
PDB Entry: 3fb6 (more details), 3 Å
SCOPe Domain Sequences for d3fb6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fb6c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv tlwgrcvavvvmvagitsfglvtaalatwf
Timeline for d3fb6c_: