SCOPe 2.07: Domain d3fb6b1: 3fb6 B:1-107

Lineage for d3fb6b1 (3fb6 B:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3fb6b1: 3fb6 B:1-107 [246072]
   Other proteins in same PDB: d3fb6b2, d3fb6c_
   automated match to d4ma7l1
   complexed with k

Details for d3fb6b1

PDB Entry: 3fb6, 3 Å

PDB Description: kcsa potassium channel in the partially open state with 16 a opening at t112

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3fb6b1:

Sequence; same for both SEQRES and ATOM records:

>d3fb6b1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d3fb6b1:

• d3fb6b1 first appeared in SCOPe 2.04
  
• d3fb6b1 appears in SCOPe 2.06
  
• d3fb6b1 appears in the current release, SCOPe 2.08