Lineage for d3fa4l_ (3fa4 L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838329Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2838330Protein automated matches [190614] (15 species)
    not a true protein
  7. 2838338Species Aspergillus niger [TaxId:5061] [255825] (2 PDB entries)
  8. 2838350Domain d3fa4l_: 3fa4 L: [246071]
    automated match to d3m0ja_
    complexed with mg

Details for d3fa4l_

PDB Entry: 3fa4 (more details), 2.18 Å

PDB Description: Crystal structure of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member, triclinic crystal form
PDB Compounds: (L:) 2,3-dimethylmalate lyase

SCOPe Domain Sequences for d3fa4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fa4l_ c.1.12.0 (L:) automated matches {Aspergillus niger [TaxId: 5061]}
taatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgict
lndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqtkrc
ghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardag
advgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaal
gpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag

SCOPe Domain Coordinates for d3fa4l_:

Click to download the PDB-style file with coordinates for d3fa4l_.
(The format of our PDB-style files is described here.)

Timeline for d3fa4l_: