SCOP 1.57: Domain d1ffkq_: 1ffk Q:

Lineage for d1ffkq_ (1ffk Q:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families)

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [50107] (2 PDB entries)

8. Domain d1ffkq_: 1ffk Q: [24605]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkq_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkq_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkq_ b.34.5.1 (Q:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1ffkq_:

• d1ffkq_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkq_ appears in SCOP 1.59
  
• d1ffkq_ appears in the current release, SCOPe 2.08