SCOPe 2.06: Domain d3f1rb_: 3f1r B:

Lineage for d3f1rb_ (3f1r B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)

8. Domain d3f1rb_: 3f1r B: [246017]
   automated match to d1ihka_
   complexed with so4

Details for d3f1rb_

PDB Entry: 3f1r, 2.5 Å

PDB Description: Crystal structure of FGF20 dimer

PDB Compounds: (B:) Fibroblast growth factor 20

SCOPe Domain Sequences for d3f1rb_:

Sequence; same for both SEQRES and ATOM records:

>d3f1rb_ b.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgaaqlahlhgilrrrqlycrtgfhlqilpdgsvqgtrqdhslfgilefisvavglvsir
gvdsglylgmndkgelygsekltsecifreqfeenwyntyssniykhgdtgrryfvalnk
dgtprdgarskrhqkfthflprpvdpervpelykdll

Timeline for d3f1rb_:

• d3f1rb_ first appeared in SCOPe 2.04
  
• d3f1rb_ appears in SCOPe 2.05
  
• d3f1rb_ appears in SCOPe 2.07
  
• d3f1rb_ appears in the current release, SCOPe 2.08