Lineage for d2ahjd_ (2ahj D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) 
Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) 
Family b.34.4.4: Nitrile hydratase beta chain [50101] (1 protein) Protein Nitrile hydratase beta chain [50102] (1 species) Species Rhodococcus erythropolis [50103] (2 PDB entries) 
Domain d2ahjd_: 2ahj D: [24600]
Other proteins in same PDB: d2ahja_, d2ahjc_
Details for d2ahjd_
PDB Entry: 2ahj (more details), 1.7 Å
PDB Description: nitrile hydratase complexed with nitric oxide
SCOP Domain Sequences for d2ahjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahjd_ b.34.4.4 (D:) Nitrile hydratase beta chain {Rhodococcus erythropolis}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa
SCOP Domain Coordinates for d2ahjd_:
Click to download the PDB-style file with coordinates for d2ahjd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ahjd_:
- d2ahjd_ appears in SCOP 1.57
- d2ahjd_ appears in the current release, SCOPe 2.08
View in 3D
