SCOPe 2.08: Domain d3ey4c_: 3ey4 C:

Lineage for d3ey4c_ (3ey4 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
   Uniprot P28845

8. Domain d3ey4c_: 3ey4 C: [245990]
   automated match to d3pdjb_
   complexed with 352, ndp

Details for d3ey4c_

PDB Entry: 3ey4, 3 Å

PDB Description: further studies with the 2-amino-1,3-thiazol-4(5h)-one class of 11- hydroxysteroid dehydrogenase type 1 (11-hsd1) inhibitors: reducing pregnane x receptor (pxr) activity and exploring activity in a monkey pharmacodynamic model

PDB Compounds: (C:) 11-beta-hydroxysteroid dehydrogenase 1

SCOPe Domain Sequences for d3ey4c_:

Sequence; same for both SEQRES and ATOM records:

>d3ey4c_ c.2.1.2 (C:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
llirnpsrkileflys

Timeline for d3ey4c_:

• d3ey4c_ first appeared in SCOPe 2.04
  
• d3ey4c_ appears in SCOPe 2.07