Lineage for d1vif__ (1vif -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165661Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 165662Family b.34.4.1: R67 dihydrofolate reductase [50091] (1 protein)
  6. 165663Protein R67 dihydrofolate reductase [50092] (1 species)
  7. 165664Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries)
  8. 165666Domain d1vif__: 1vif - [24593]

Details for d1vif__

PDB Entry: 1vif (more details), 1.8 Å

PDB Description: structure of dihydrofolate reductase

SCOP Domain Sequences for d1vif__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vif__ b.34.4.1 (-) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1}
psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOP Domain Coordinates for d1vif__:

Click to download the PDB-style file with coordinates for d1vif__.
(The format of our PDB-style files is described here.)

Timeline for d1vif__: